PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C026230P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family Trihelix
Protein Properties Length: 911aa    MW: 100774 Da    PI: 8.6095
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C026230P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix64.91.8e-20817897185
        trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdql 85 
                     +W+ +e+++Li++r +++ r++ ++ +++lWee+s+ m + g++rsp qCk+ w +l ++++++ ++ekk  s+  +++py++++
  MELO3C026230P1 817 KWKPEEIKKLIKLRGQLHARFQVTRGRMALWEEISNGMLADGINRSPGQCKSLWTSLVQKFEQESKSEKK--SK--KSWPYLEEM 897
                     7********************************************************************9..34..56*****99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.60.15.101.7E-6899349IPR001279Metallo-beta-lactamase
SuperFamilySSF562813.05E-72100514IPR001279Metallo-beta-lactamase
SMARTSM008494.9E-25112309IPR001279Metallo-beta-lactamase
PfamPF127062.8E-11124259IPR001279Metallo-beta-lactamase
PfamPF075211.5E-5455486IPR011108Zn-dependent metallo-hydrolase, RNA specificity domain
PROSITE profilePS500908.107810874IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.602.3E-5811876IPR009057Homeodomain-like
SMARTSM007170.0037814876IPR001005SANT/Myb domain
PfamPF138371.5E-17815898No hitNo description
CDDcd122031.24E-21816878No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009658Biological Processchloroplast organization
GO:0009942Biological Processlongitudinal axis specification
GO:0060918Biological Processauxin transport
GO:0009507Cellular Componentchloroplast
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 911 aa     Download sequence    Send to blast
MQLEFLGGSS ILGSSHSAPY KQRMASFGAL SLCPCSPLLR PHHPVRTIYC CHGSPTVLGK  60
NVSKVPRKRP GRLEGAKRSM EDSVQRKMEQ FYEGSDGPPL RVLPIGGLGE IGMNCMLVGN  120
YDRYILIDAG VMFPDHDELG VQKIIPDTTF IKRWSHKIEA VVITHGHEDH IGALPWVIPA  180
LDSHTPIYAS SFTVELIKKR LKENGIFVPS RLKVFKMRKR FTAGPFEIEP IRVTHSIPDC  240
CGLVLRCTDG TILHTGDWKI DESPLDGKVF DRETLEQLSK EGVTLMMSDS TNVLSPGRTI  300
SESVVADALL RRISAAKGRV ITTQFASNIH RLGSVKAAAD LTGRKLVFVG MSLRTYLDAA  360
WKDGKAPIDP STLVKVEDID AYAPKDLLIV TTGSQAEPRA ALNLASYGSS HSLKLSKEDM  420
ILYSAKVIPG NESRVMKMLN RISEIGSNII MGKNELLHTS GHGYRGELEE VLQIVKPQHF  480
LPIHGELLFL KEHELLGRST GIRHTTVIKN GEMLGVSHLR NRRVLSNGFT SLGRENLQLK  540
YSDGDKAFGS SSELFVDERL KIATDGIIVV SMEILRPQSV DGLNGTGIKG KLRITTRCLW  600
LDKGKLLDAL HKAAHAALSS CPVNCPLAHM ERTVSELLRK MVRKYSGKRP EVIVMAVESP  660
GGVLSEELGA RLSGKSYSGF GMSASRKAVD EQPTKSHLNS IRPDGNNDLP SEDNSSQESQ  720
GYHLESERLL PEEDYDTTNL NLTETQSFDN EGLEDFWKPF ITPSSPANEL AKDHEGSVQH  780
LKNALEISNE REEVSDDKSL KTSNSDVNSS KPVKRNKWKP EEIKKLIKLR GQLHARFQVT  840
RGRMALWEEI SNGMLADGIN RSPGQCKSLW TSLVQKFEQE SKSEKKSKKS WPYLEEMSGI  900
LSDSEAVATK *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5a0t_A9e-8510065819560RIBONUCLEASE J
5a0t_B9e-8510065819560RIBONUCLEASE J
5a0v_A9e-8510065819560RIBONUCLEASE J
5a0v_B9e-8510065819560RIBONUCLEASE J
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008464473.10.0PREDICTED: uncharacterized protein LOC103502342 isoform X1
TrEMBLA0A0A0LRV70.0A0A0A0LRV7_CUCSA; Uncharacterized protein
STRINGPOPTR_0012s09780.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF50993450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G63420.10.0Trihelix family protein